PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G139000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 270aa    MW: 29575.2 Da    PI: 8.6083
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G139000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171865148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT +Ed+ll++ v+q+G g+W+++++  g++R++k+c++rw +yl
  Brast09G139000.1.p 18 KGPWTGQEDKLLLEHVRQHGDGRWNSVSKLTGLKRSGKSCRLRWVNYL 65
                        79********************************************97 PP

2Myb_DNA-binding551.9e-1771115147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg++T++E+  +v++++++G++ W+tIar ++ gRt++++k++w+++
  Brast09G139000.1.p  71 RGKMTPQEESTIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 115
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7481365IPR017930Myb domain
SuperFamilySSF466896.25E-2916112IPR009057Homeodomain-like
SMARTSM007172.1E-151767IPR001005SANT/Myb domain
PfamPF002491.6E-161865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-221972IPR009057Homeodomain-like
CDDcd001673.92E-112065No hitNo description
PROSITE profilePS5129425.16366120IPR017930Myb domain
SMARTSM007178.8E-1670118IPR001005SANT/Myb domain
PfamPF002493.3E-1571115IPR001005SANT/Myb domain
CDDcd001673.46E-1073116No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2373118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MADGQVAGWG VQDDGWRKGP WTGQEDKLLL EHVRQHGDGR WNSVSKLTGL KRSGKSCRLR  60
WVNYLRPDLK RGKMTPQEES TIVQLHALWG NRWSTIARSL PGRTDNEIKN YWRTHFKKGK  120
PSKNIERARA RFLKQRREMQ QQQQQQQQQS LLLVGQGNKA AAAAERTAGI VVEDEHSTMG  180
VATSLMAGAG HDHREELMMQ DVMDFLCPMS CVLQLQGGGG GGGGAGSSCC ASTSEGYGSS  240
EDDGATWGSL WNLEDVVVHG VGGGACTLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261811827126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-139AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581410.11e-150PREDICTED: myb-related protein 340
TrEMBLA0A0Q3KTE71e-150A0A0Q3KTE7_BRADI; Uncharacterized protein
STRINGSi010822m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-65myb domain protein 79